Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

delta-like 1 (Drosophila), Mouse, Clone: 4F9, Abnova™

Catalog No. 89001256 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-256 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-256 Supplier Abnova Corporation Supplier No. H00028514M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant DLL1.

DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq

Sequence: QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR

Specifications

Antigen delta-like 1 (Drosophila)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DLL1.
Formulation PBS with no preservative; pH 7.4
Gene DLL1
Gene Accession No. NM_005618
Gene Alias DELTA1/DL1/Delta
Gene Symbols DLL1
Host Species Mouse
Immunogen DLL1 (NP_005609, 18 a.a. ∼ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Neurobiology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 28514
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.