delta-like 1 (Drosophila), Mouse, Clone: 4F9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DLL1.

Supplier:  Abnova Corporation H00028514M02

Catalog No. 89-001-256

Description

DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. [provided by RefSeq

Sequence: QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR

Specifications

• Antigen: delta-like 1 (Drosophila)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005618
• Gene Symbols: DLL1
• Immunogen: DLL1 (NP_005609, 18 a.a. ∼ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Neurobiology
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4F9
• Description: Mouse monoclonal antibody raised against a partial recombinant DLL1.
• Gene: DLL1
• Gene Alias: DELTA1/DL1/Delta
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 28514
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ