DLX1, Mouse, Clone: 2H3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DLX1.

Supplier:  Abnova Corporation H00001745M01

Catalog No. 89-021-308

Description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq

Sequence: YLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQLM

Specifications

• Antigen: DLX1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_178120
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1745
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid

• Applications: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
• Clone: 2H3
• Description: Mouse monoclonal antibody raised against a partial recombinant DLX1.
• Gene: DLX1
• Gene Symbols: DLX1
• Immunogen: DLX1 (NP_835221, 152 a.a. ∼ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG2a κ