DLX2, Mouse, Clone: 3G6, Abnova™

Catalog No.	Quantity
89-021-319	100 μg

Catalog No. 89-021-319 Supplier Abnova Corporation Supplier No. H00001746M08

Description

Mouse monoclonal antibody raised against a full-length recombinant DLX2.

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. [provided by RefSeq

Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGT

Specifications

• Antigen: DLX2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant DLX2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DLX2
• Gene Accession No.: NM_004405
• Gene Alias: TES-1/TES1
• Gene Symbols: DLX2
• Host Species: Mouse
• Immunogen: DLX2 (NP_004396, 1 a.a. ∼ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1746
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ