DLX3, Mouse, Clone: 4F8, Abnova™

Catalog No.	Quantity
89-021-320	100 μg

Catalog No. 89-021-320 Supplier Abnova Corporation Supplier No. H00001747M01

Description

Mouse monoclonal antibody raised against a full-length recombinant DLX3.

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq

Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

Specifications

• Antigen: DLX3
• Applications: ELISA, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 4F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant DLX3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DLX3
• Gene Accession No.: BC012361
• Gene Alias: AI4/TDO
• Gene Symbols: DLX3
• Host Species: Mouse
• Immunogen: DLX3 (AAH12361, 1 a.a. ∼ 287 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1747
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ