Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123150

DLX6, Mouse, Clone: 2D7, Abnova™

Catalog No. 89123150 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-150 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-150 Supplier Abnova Corporation Supplier No. H00001750M06
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DLX6.

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq

Sequence: PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ

Specifications

Antigen DLX6
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2D7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DLX6.
Formulation PBS with no preservative; pH 7.4
Gene DLX6
Gene Accession No. XM_376652
Gene Alias MGC125282/MGC125283/MGC125284/MGC125285
Gene Symbols DLX6
Host Species Mouse
Immunogen DLX6 (XP_376652, 71 a.a. ∼ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1750
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.