distal-less homeobox 6, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human DLX6 protein.

Supplier:  Abnova Corporation H00001750D01P

Catalog No. 89-017-568

Description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq

Sequence: MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM

Specifications

• Antigen: distal-less homeobox 6
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human DLX6 protein.
• Gene: DLX6
• Gene Alias: MGC125282/MGC125283/MGC125284/MGC125285
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC069363.1
• Gene Symbols: DLX6
• Immunogen: DLX6 (AAH69363.1, 1 a.a. ∼ 175 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Neurobiology
• Gene ID (Entrez): 1750
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG