DNA methyltransferase 1 associated protein 1, Mouse, Clone: 5H4, Abnova™

Catalog No.	Quantity
89-001-317	100 μg

Catalog No. 89-001-317 Supplier Abnova Corporation Supplier No. H00055929M03

Description

Mouse monoclonal antibody raised against a partial recombinant DMAP1.

This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq

Sequence: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF

Specifications

• Antigen: DNA methyltransferase 1 associated protein 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5H4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DMAP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DMAP1
• Gene Accession No.: NM_019100
• Gene Alias: DKFZp686L09142/DNMAP1/DNMTAP1/EAF2/FLJ11543/KIAA1425/SWC4
• Gene Symbols: DMAP1
• Host Species: Mouse
• Immunogen: DMAP1 (NP_061973, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55929
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ