DMP1, Mouse, Clone: 1D4, Abnova™

Catalog No.	Quantity
89-021-333	100 μg

Catalog No. 89-021-333 Supplier Abnova Corporation Supplier No. H00001758M01

Description

Mouse monoclonal antibody raised against a partial recombinant DMP1.

Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: ESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEES

Specifications

• Antigen: DMP1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1D4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DMP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DMP1
• Gene Accession No.: NM_004407
• Gene Alias: DMP-1
• Gene Symbols: DMP1
• Host Species: Mouse
• Immunogen: DMP1 (NP_004398.1, 221 a.a. ∼ 330 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1758
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ