DNM2, Mouse, Clone: 6C9, Abnova™

Catalog No.	Quantity
89-021-338	100 μg

Catalog No. 89-021-338 Supplier Abnova Corporation Supplier No. H00001785M01

Description

Mouse monoclonal antibody raised against a partial recombinant DNM2.

Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Four alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined. [provided by RefSeq

Sequence: SWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAD

Specifications

• Antigen: DNM2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DNM2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DNM2
• Gene Accession No.: BC054501
• Gene Alias: CMTDI1/CMTDIB/DI-CMTB/DYN2/DYNII
• Gene Symbols: DNM2
• Host Species: Mouse
• Immunogen: DNM2 (AAH54501, 611 a.a. ∼ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1785
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ