Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

dynamin binding protein, Mouse, Clone: 3H7, Abnova™

Catalog No. 89001223 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-223 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-223 Supplier Abnova Corporation Supplier No. H00023268M03
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant DNMBP.

DNMBP belongs to the DBL (MIM 311030) family of guanine nucleotide exchange factors and plays a role in the regulation of cell junctions (Otani et al., 2006 [PubMed 17015620]).[supplied by OMIM

Sequence: TKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLK

Specifications

Antigen dynamin binding protein
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3H7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DNMBP.
Formulation PBS with no preservative; pH 7.4
Gene DNMBP
Gene Accession No. BC041628
Gene Alias KIAA1010/TUBA
Gene Symbols DNMBP
Host Species Mouse
Immunogen DNMBP (AAH41628, 491 a.a. ∼ 590 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 23268
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.