DNTT, Mouse, Clone: 4H5, Abnova™

Catalog No.	Quantity
89-021-340	100 μg

Catalog No. 89-021-340 Supplier Abnova Corporation Supplier No. H00001791M01

Description

Mouse monoclonal antibody raised against a partial recombinant DNTT.

This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq]

Sequence: MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC

Specifications

• Antigen: DNTT
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4H5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DNTT.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DNTT
• Gene Accession No.: BC012920
• Gene Alias: TDT
• Gene Symbols: DNTT
• Host Species: Mouse
• Immunogen: DNTT (AAH12920, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1791
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ