Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021341

DOCK1, Mouse, Clone: 3D10, Abnova™

Catalog No. 89021341 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-341 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-341 Supplier Abnova Corporation Supplier No. H00001793M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DOCK1.

This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. [provided by RefSeq

Sequence: LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPT

Specifications

Antigen DOCK1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3D10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DOCK1.
Formulation PBS with no preservative; pH 7.4
Gene DOCK1
Gene Accession No. NM_001380
Gene Alias DOCK180/ced5
Gene Symbols DOCK1
Host Species Mouse
Immunogen DOCK1 (NP_001371, 698 a.a. ∼ 803 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1793
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.