Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021343

DPAGT1, Mouse, Clone: 1G1, Abnova™

Catalog No. 89021343 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-343 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-343 Supplier Abnova Corporation Supplier No. H00001798M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant DPAGT1.

The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. [provided by RefSeq

Sequence: IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER

Specifications

Antigen DPAGT1
Applications ELISA
Classification Monoclonal
Clone 1G1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DPAGT1.
Formulation PBS with no preservative; pH 7.4
Gene DPAGT1
Gene Accession No. NM_001382
Gene Alias ALG7/CDG-Ij/D11S366/DGPT/DPAGT/DPAGT2/G1PT/GPT/UAGT/UGAT
Gene Symbols DPAGT1
Host Species Mouse
Immunogen DPAGT1 (NP_001373, 296 a.a. ∼ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1798
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.