DR1-associated protein 1 (negative cofactor 2 alpha), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant DRAP1.

Manufacturer:  Abnova Corporation H00010589A01

Catalog No. 89-004-500

Description

Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq

Sequence: PSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGD

Specifications

• Antigen: DR1-associated protein 1 (negative cofactor 2 alpha)
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006442
• Gene Alias: NC2-alpha
• Host Species: Mouse
• Quantity: 50 uL
• Research Discipline: Transcription Regulation
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant DRAP1.
• Gene: DRAP1
• Format: Serum
• Gene Symbols: DRAP1
• Immunogen: DRAP1 (NP_006433, 2 a.a. ~ 105 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 10589