DRD2, Mouse, Clone: 1B11, Abnova™

Catalog No.	Quantity
89-021-353	200 μL

Catalog No. 89-021-353 Supplier Abnova Corporation Supplier No. H00001813M01A

Description

Mouse monoclonal antibody raised against a partial recombinant DRD2.

This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing. [provided by RefSeq

Sequence: MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIF

Specifications

• Antigen: DRD2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DRD2.
• Formulation: ascites with no preservative
• Gene: DRD2
• Gene Accession No.: BC021195
• Gene Alias: D2DR/D2R
• Gene Symbols: DRD2
• Host Species: Mouse
• Immunogen: DRD2 (AAH21195, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1813
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG2a κ