Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DSC3, Mouse, Clone: 4D2, Abnova™

Catalog No. 89021357 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-357 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-357 Supplier Abnova Corporation Supplier No. H00001825M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant DSC3.

The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation. The desmosomal family members are arranged in two clusters on chromosome 18, occupying less than 650kb combined. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq

Sequence: CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST

Specifications

Antigen DSC3
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4D2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant DSC3.
Formulation PBS with no preservative; pH 7.4
Gene DSC3
Gene Accession No. NM_001941
Gene Alias CDHF3/DSC/DSC1/DSC2/DSC4/HT-CP
Gene Symbols DSC3
Host Species Mouse
Immunogen DSC3 (NP_001932, 585 a.a. ∼ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1825
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.