DST, Mouse, Clone: 1B10, Abnova™

Catalog No.	Quantity
89-016-355	100 μg

Catalog No. 89-016-355 Supplier Abnova Corporation Supplier No. H00000667M01

Description

Mouse monoclonal antibody raised against a partial recombinant DST.

This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been known that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. [provided by RefSeq

Sequence: EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS

Specifications

• Antigen: DST
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DST.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DST
• Gene Accession No.: NM_183380
• Gene Alias: BP240/BPA/BPAG1/CATX-15/D6S1101/DKFZp564B2416/DMH/DT/FLJ46791/KIAA0465/KIAA1470/MACF2
• Gene Symbols: DST
• Host Species: Mouse
• Immunogen: DST (NP_899236, 401 a.a. ∼ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 667
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ