melanoregulin, Mouse, Clone: 1A7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant DSU.

Supplier:  Abnova Corporation H00055686M02

Catalog No. 89-001-309

Description

Sequence: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP

Specifications

• Antigen: melanoregulin
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC032747
• Gene Symbols: MREG
• Immunogen: DSU (AAH32747, 1 a.a. ∼ 214 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 55686
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ

• Applications: ELISA, Western Blot
• Clone: 1A7
• Description: Mouse monoclonal antibody raised against a full length recombinant DSU.
• Gene: MREG
• Gene Alias: DSU/FLJ10116/MGC90296/WDT2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody