DTD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188776

Catalog No. NBP188776

Description

DTD1 Polyclonal specifically detects DTD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DTD1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: bA379J5.3, bA555E18.1, C20orf88HARS2, chromosome 20 open reading frame 88, DNA-unwinding element-binding protein, D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae), D-tyrosyl-tRNA(Tyr) deacylase 1, DUEB, EC 3.1, Histidyl-tRNA synthase-related, histidyl-tRNA synthetase 2, MGC119131, MGC41905, pqn-68
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DTD1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEILCVSQFT
• Quantity: 0.1 mL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 92675
• Target Species: Human
• Isotype: IgG

For Research Use Only