DUSP1, Mouse, Clone: 3A9, Abnova™

Catalog No.	Quantity
89-021-367	100 μg

Catalog No. 89-021-367 Supplier Abnova Corporation Supplier No. H00001843M05

Description

Mouse monoclonal antibody raised against a partial recombinant DUSP1.

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the nonreceptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. [provided by RefSeq

Sequence: LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

Specifications

• Antigen: DUSP1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DUSP1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DUSP1
• Gene Accession No.: NM_004417
• Gene Alias: CL100/HVH1/MKP-1/MKP1/PTPN10
• Gene Symbols: DUSP1
• Host Species: Mouse
• Immunogen: DUSP1 (NP_004408, 305 a.a. ∼ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1843
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ