Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DUSP3, Mouse, Clone: 5B7, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant DUSP3.

Manufacturer:  Abnova Corporation H00001845M01A

Catalog No. 89-021-369


  Check Availability
Add to cart

Specifications

Description

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. [provided by RefSeq

Sequence: MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Description & Specifications

Specifications

DUSP3
5B7
dual specificity phosphatase 3
DUSP3
Ascites
DUSP3
DUSP3 (AAH02682, 1 a.a. ∽186 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kDa
200μL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In ascites fluid
BC002682
VHR
Murine
IgG2a, κ
RUO
Primary
1845
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit