DUSP5, Mouse, Clone: 3D8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant DUSP5.

Manufacturer: Abnova Corporation H00001847M02A

Catalog No. 89-021-371

  Check Availability
Add to Cart

    Specifications

    Antigen DUSP5
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 3D8
    Conjugate Unlabeled
    Cross Reactivity Human
    Description dual specificity phosphatase 5
    Format Ascites
    Formulation In ascites fluid
    Gene DUSP5
    Gene Accession No. NM_004419
    Gene Alias DUSP, HVH3
    Gene Symbols DUSP5
    Host Species Mouse
    Immunogen DUSP5 (NP_004410, 286 a.a. ∽385 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG1, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1847

    The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq

    Sequence: LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit