DUSP5, Mouse, Clone: 3D8, Abnova™

Catalog No.	Quantity
89-021-371	200 μL

Catalog No. 89-021-371 Supplier Abnova Corporation Supplier No. H00001847M02A

Description

Mouse monoclonal antibody raised against a partial recombinant DUSP5.

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq

Sequence: LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC

Specifications

• Antigen: DUSP5
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3D8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DUSP5.
• Formulation: ascites with no preservative
• Gene: DUSP5
• Gene Accession No.: NM_004419
• Gene Alias: DUSP/HVH3
• Gene Symbols: DUSP5
• Host Species: Mouse
• Immunogen: DUSP5 (NP_004410, 286 a.a. ∼ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1847
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG1 κ