deoxyuridine triphosphatase, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-017-578	100 μg

Catalog No. 89-017-578 Supplier Abnova Corporation Supplier No. H00001854D01P

Description

Rabbit polyclonal antibody raised against a full-length human DUT protein.

This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. [provided by RefSeq

Sequence: MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Specifications

• Antigen: deoxyuridine triphosphatase
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human DUT protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DUT
• Gene Accession No.: NM_001025248
• Gene Alias: FLJ20622/dUTPase
• Gene Symbols: DUT
• Host Species: Rabbit
• Immunogen: DUT (NP_001020419.1, 1 a.a. ∼ 252 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Endocrine/Metabolism
• Primary or Secondary: Primary
• Gene ID (Entrez): 1854
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG