dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2, Mouse, Clone: 6E2, Abnova™

Catalog No.	Quantity
89-001-080	100 μg

Catalog No. 89-001-080 Supplier Abnova Corporation Supplier No. H00008445M02

Description

Mouse monoclonal antibody raised against a partial recombinant DYRK2.

DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert. [provided by RefSeq]

Sequence: MNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHH

Specifications

• Antigen: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6E2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant DYRK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: DYRK2
• Gene Accession No.: BC005809
• Gene Alias: FLJ21217/FLJ21365
• Gene Symbols: DYRK2
• Host Species: Mouse
• Immunogen: DYRK2 (AAH05809, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8445
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ