E2F transcription factor 3, Mouse, Clone: 5F7, Abnova™

Catalog No.	Quantity
89-014-098	100 μg

Catalog No. 89-014-098 Supplier Abnova Corporation Supplier No. H00001871M01

Description

Mouse monoclonal antibody raised against a partial recombinant E2F3.

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner. [provided by RefSeq

Sequence: QIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNL

Specifications

• Antigen: E2F transcription factor 3
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 5F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant E2F3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: E2F3
• Gene Accession No.: NM_001949
• Gene Alias: DKFZp686C18211/E2F-3/KIAA0075/MGC104598
• Gene Symbols: E2F3
• Host Species: Mouse
• Immunogen: E2F3 (NP_001940, 336 a.a. ∼ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 1871
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ