E2F4, Mouse, Clone: 5B7, Abnova™

Catalog No.	Quantity
89-021-380	100 μg

Catalog No. 89-021-380 Supplier Abnova Corporation Supplier No. H00001874M01

Description

Mouse monoclonal antibody raised against a partial recombinant E2F4.

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. [provided by RefSeq

Sequence: PPEDLLQSPSAVSTPPPLPKPALAQSQEASRPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ*

Specifications

• Antigen: E2F4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5B7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant E2F4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: E2F4
• Gene Accession No.: NM_001950
• Gene Alias: E2F-4
• Gene Symbols: E2F4
• Host Species: Mouse
• Immunogen: E2F4 (NP_001941, 211 a.a. ∼ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1874
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ