Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

early B-cell factor 3, Mouse, Clone: 8D6, Abnova™

Catalog No. 89014353 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-353 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-353 Supplier Abnova Corporation Supplier No. H00253738M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant EBF3.

Sequence: LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS

Specifications

Antigen early B-cell factor 3
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 8D6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EBF3.
Formulation PBS with no preservative; pH 7.4
Gene EBF3
Gene Accession No. NM_001005463
Gene Alias COE3/O/E-2
Gene Symbols EBF3
Host Species Mouse
Immunogen EBF3 (NP_001005463, 381 a.a. ∼ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 253738
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.