Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014254

Epstein-Barr virus induced 3, Mouse, Clone: 1D3, Abnova™

Catalog No. 89014254 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-254 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-254 Supplier Abnova Corporation Supplier No. H00010148M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant EBI3. (Please note that this antibody can't conjugate with biotin, biotinylation will lead to lost of antibody specificity)

This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq]

Sequence: PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Specifications

Antigen Epstein-Barr virus induced 3
Applications ELISA
Classification Monoclonal
Clone 1D3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EBI3. (Please notice that this antibody can't conjugate with biotin, biotinylation will lead to lost of antibody specificity)
Formulation PBS with no preservative; pH 7.4
Gene EBI3
Gene Accession No. NM_005755
Gene Alias IL27B
Gene Symbols EBI3
Host Species Mouse
Immunogen EBI3 (NP_005746, 129 a.a. ∼ 229 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cytokines
Primary or Secondary Primary
Gene ID (Entrez) 10148
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.