Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004473

Epstein-Barr virus induced 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004473 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-473 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-473 Supplier Abnova Corporation Supplier No. H00010148A02
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant EBI3.

This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq]

Sequence: PDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Specifications

Antigen Epstein-Barr virus induced 3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant EBI3.
Formulation 50% glycerol
Gene EBI3
Gene Accession No. NM_005755
Gene Alias IL27B
Gene Symbols EBI3
Host Species Mouse
Immunogen EBI3 (NP_005746, 129 a.a. ∼ 229 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Cytokines
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10148
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.