EDG3, Mouse, Clone: 2G11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EDG3.

Supplier:  Abnova Corporation H00001903M02

Catalog No. 89-021-387

Description

This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function. [provided by RefSeq

Sequence: SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN

Specifications

• Antigen: EDG3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005226
• Gene Symbols: S1PR3
• Immunogen: EDG3 (NP_005217.2, 302 a.a. ∼ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Immunohistochemistry (PFA fixed)
• Clone: 2G11
• Description: Mouse monoclonal antibody raised against a partial recombinant EDG3.
• Gene: S1PR3
• Gene Alias: EDG-3/EDG3/FLJ37523/FLJ93220/LPB3/MGC71696/S1P3
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1903
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid