Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

early endosome antigen 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EEA1.

Manufacturer:  Abnova Corporation H00008411A01

Catalog No. 89-004-390


Add to cart

Description

Description

Sequence: KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Specifications

Specifications

early endosome antigen 1
Unconjugated
50% glycerol
NM_003566
MST105|MSTP105|ZFYVE2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8411
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant EEA1.
EEA1
Serum
EEA1
EEA1 (NP_003557, 1312 a.a. ~ 1411 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human, Murine, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit