Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89015814

eukaryotic translation elongation factor 1 alpha 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89015814 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-015-814 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-015-814 Supplier Abnova Corporation Supplier No. H00001915A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant EEF1A1.

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq

Sequence: DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK

Specifications

Antigen eukaryotic translation elongation factor 1 alpha 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant EEF1A1.
Formulation 50% glycerol
Gene EEF1A1
Gene Accession No. BC009875
Gene Alias CCS-3/CCS3/EEF-1/EEF1A/EF-Tu/EF1A/FLJ25721/GRAF-1EF/HNGC:16303/LENG7/MGC102687/MGC131894/MGC16224/PTI1/eEF1A-1
Gene Symbols EEF1A1
Host Species Mouse
Immunogen EEF1A1 (AAH09875, 156 a.a. ∼ 255 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1915
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.