eukaryotic translation elongation factor 1 alpha 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EEF1A1.

Supplier:  Abnova Corporation H00001915A01

Catalog No. 89-015-814

Description

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. [provided by RefSeq

Sequence: DSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYK

Specifications

• Antigen: eukaryotic translation elongation factor 1 alpha 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant EEF1A1.
• Gene: EEF1A1
• Gene Alias: CCS-3/CCS3/EEF-1/EEF1A/EF-Tu/EF1A/FLJ25721/GRAF-1EF/HNGC:16303/LENG7/MGC102687/MGC131894/MGC16224/PTI1/eEF1A-1
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC009875
• Gene Symbols: EEF1A1
• Immunogen: EEF1A1 (AAH09875, 156 a.a. ∼ 255 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 1915
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.