eukaryotic translation elongation factor 1 alpha 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-106	50 μL

Catalog No. 89-004-106 Supplier Abnova Corporation Supplier No. H00001917A01

Description

Mouse polyclonal antibody raised against a partial recombinant EEF1A2.

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG

Specifications

• Antigen: eukaryotic translation elongation factor 1 alpha 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
• Formulation: 50% glycerol
• Gene: EEF1A2
• Gene Accession No.: NM_001958
• Gene Alias: EEF1AL/EF-1-alpha-2/EF1A/FLJ41696/HS1/STN/STNL
• Gene Symbols: EEF1A2
• Host Species: Mouse
• Immunogen: EEF1A2 (NP_001949, 364 a.a. ∼ 462 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1917
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum