eukaryotic translation elongation factor 1 alpha 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EEF1A2.

Manufacturer:  Abnova Corporation H00001917A01

Catalog No. 89-004-106

Description

This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: HTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAG

Specifications

• Antigen: eukaryotic translation elongation factor 1 alpha 2
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001958
• Gene Alias: EEF1AL|EF-1-alpha-2|EF1A|FLJ41696|HS1|STN|STNL
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 1917

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant EEF1A2.
• Gene: EEF1A2
• Format: Serum
• Gene Symbols: EEF1A2
• Immunogen: EEF1A2 (NP_001949, 364 a.a. ~ 462 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human, Murine, Rat