Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021393

EEF1B2, Mouse, Clone: 3A5, Abnova™

Catalog No. 89021393 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-393 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-393 Supplier Abnova Corporation Supplier No. H00001933M10
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant EEF1B2.

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq]

Sequence: VPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSG

Specifications

Antigen EEF1B2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3A5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EEF1B2.
Formulation PBS with no preservative; pH 7.4
Gene EEF1B2
Gene Accession No. NM_001959.3
Gene Alias EEF1B/EEF1B1/EF1B
Gene Symbols EEF1B2
Host Species Mouse
Immunogen EEF1B2 (NP_001950.1, 29 a.a. ∼ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1933
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.