Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021394

EEF1D, Mouse, Clone: 4B12, Abnova™

Catalog No. 89021394 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-394 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-394 Supplier Abnova Corporation Supplier No. H00001936M04
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant EEF1D.

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq

Sequence: MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS

Specifications

Antigen EEF1D
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4B12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EEF1D.
Formulation PBS with no preservative; pH 7.4
Gene EEF1D
Gene Accession No. NM_032378
Gene Alias EF-1D/EF1D/FLJ20897/FP1047
Gene Symbols EEF1D
Host Species Mouse
Immunogen EEF1D (NP_115754, 1 a.a. ∼ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1936
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.