eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-107	50 μL

Catalog No. 89-004-107 Supplier Abnova Corporation Supplier No. H00001936A01

Description

Mouse polyclonal antibody raised against a partial recombinant EEF1D.

This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq

Sequence: MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS

Specifications

• Antigen: eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EEF1D.
• Formulation: 50% glycerol
• Gene: EEF1D
• Gene Accession No.: NM_032378
• Gene Alias: EF-1D/EF1D/FLJ20897/FP1047
• Gene Symbols: EEF1D
• Host Species: Mouse
• Immunogen: EEF1D (NP_115754, 1 a.a. ∼ 91 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1936
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum