Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001357

EF-hand domain family, member D1, Mouse, Clone: 1H7, Abnova™

Catalog No. 89001357 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-357 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-357 Supplier Abnova Corporation Supplier No. H00080303M05
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant EFHD1.

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM

Sequence: GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN

Specifications

Antigen EF-hand domain family, member D1
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1H7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant EFHD1.
Formulation PBS with no preservative; pH 7.4
Gene EFHD1
Gene Accession No. NM_025202
Gene Alias DKFZp781H0842/FLJ13612/MST133/MSTP133/PP3051
Gene Symbols EFHD1
Host Species Mouse
Immunogen EFHD1 (NP_079478.1, 168 a.a. ∼ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 80303
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.