EFNA3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EFNA3.

Supplier:  Abnova Corporation H00001944A01

Catalog No. 89-003-263

Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq

Sequence: RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY

Specifications

• Antigen: EFNA3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant EFNA3.
• Gene: EFNA3
• Gene Alias: EFL2/EPLG3/Ehk1-L/LERK3
• Host Species: Mouse
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Liquid

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004952
• Gene Symbols: EFNA3
• Immunogen: EFNA3 (NP_004943, 45 a.a. ∼ 145 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Gene ID (Entrez): 1944
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.