EFNA3, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-263	50 μL

Catalog No. 89-003-263 Supplier Abnova Corporation Supplier No. H00001944A01

Description

Mouse polyclonal antibody raised against a partial recombinant EFNA3.

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq

Sequence: RREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYY

Specifications

• Antigen: EFNA3
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant EFNA3.
• Formulation: 50% glycerol
• Gene: EFNA3
• Gene Accession No.: NM_004952
• Gene Alias: EFL2/EPLG3/Ehk1-L/LERK3
• Gene Symbols: EFNA3
• Host Species: Mouse
• Immunogen: EFNA3 (NP_004943, 45 a.a. ∼ 145 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1944
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid