epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian), Mouse, Clone: 4H2, Abnova™

Catalog No.	Quantity
89-000-618	100 μg

Catalog No. 89-000-618 Supplier Abnova Corporation Supplier No. H00001956M02

Description

Mouse monoclonal antibody raised against a partial recombinant EGFR.

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq

Sequence: EEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNY

Specifications

• Antigen: epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4H2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EGFR.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EGFR
• Gene Accession No.: NM_005228
• Gene Alias: ERBB/ERBB1/HER1/PIG61/mENA
• Gene Symbols: EGFR
• Host Species: Mouse
• Immunogen: EGFR (NP_005219, 26 a.a. ∼ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1956
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ