Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 06847MI

EGFR Rabbit anti-Human, Mouse, Rat, Hamster, Polyclonal, MilliporeSigma™

Catalog No. 06847MI Shop All MilliporeSigma Products
Change view
Click to view available options
Quantity:
200 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
06-847-MI 200 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 06-847-MI Supplier MilliporeSigma Supplier No. 06847
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Anti-EGFR Antibody detects level of EGFR and has been published and validated for use in immunoprecipitation and western blotting.
TRUSTED_SUSTAINABILITY

Specifications

Antigen EGFR
Applications Immunoprecipitation, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
Gene Symbols EGFR; ERBB1; ERBB; mENA
Host Species Rabbit
Immunogen Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the
Purification Method Protein A chromatography
Quantity 200 μg
Primary or Secondary Primary
Gene ID (Entrez) NP_005219
Target Species Hamster, Human, Mouse, Rat
Content And Storage 2-8°C for 12 months Handling Recommendations: Upon first thaw and prior to removing the cap centrifuge the vial and gently mix the solution.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.