EGFR Rabbit anti-Human, Mouse, Rat, Hamster, Polyclonal, MilliporeSigma™

Rabbit Polyclonal Antibody

Supplier:  MilliporeSigma 06847

Catalog No. 06-847-MI

Description

Anti-EGFR Antibody detects level of EGFR and has been published and validated for use in immunoprecipitation and western blotting.

Specifications

• Antigen: EGFR
• Classification: Polyclonal
• Formulation: Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
• Host Species: Rabbit
• Purification Method: Protein A chromatography
• Primary or Secondary: Primary
• Target Species: Hamster, Human, Mouse, Rat
• Form: Purified

• Applications: Immunoprecipitation, Western Blot
• Conjugate: Unconjugated
• Gene Symbols: EGFR; ERBB1; ERBB; mENA
• Immunogen: Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the
• Quantity: 200 μg
• Gene ID (Entrez): NP_005219
• Content And Storage: 2-8°C for 12 months Handling Recommendations: Upon first thaw and prior to removing the cap centrifuge the vial and gently mix the solution.
• Isotype: IgG

For Research Use Only