Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EGR1, Mouse, Clone: 6A10, Abnova™

Catalog No. 89021404 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-404 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-404 Supplier Abnova Corporation Supplier No. H00001958M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant EGR1.

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. [provided by RefSeq

Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Specifications

Antigen EGR1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6A10
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EGR1.
Formulation PBS with no preservative; pH 7.4
Gene EGR1
Gene Accession No. NM_001964
Gene Alias AT225/G0S30/KROX-24/NGFI-A/TIS8/ZIF-268/ZNF225
Gene Symbols EGR1
Host Species Mouse
Immunogen EGR1 (NP_001955, 444 a.a. ∼ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1958
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.