early growth response 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EGR1.

Supplier:  Abnova Corporation H00001958A01

Catalog No. 89-004-111

Description

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. [provided by RefSeq

Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC

Specifications

• Antigen: early growth response 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant EGR1.
• Gene: EGR1
• Gene Alias: AT225/G0S30/KROX-24/NGFI-A/TIS8/ZIF-268/ZNF225
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 1958
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001964
• Gene Symbols: EGR1
• Immunogen: EGR1 (NP_001955, 444 a.a. ∼ 543 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Serum