Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123152

EGR2, Mouse, Clone: 1G5, Abnova™

Catalog No. 89123152 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-152 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-152 Supplier Abnova Corporation Supplier No. H00001959M03
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant EGR2.

The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR

Specifications

Antigen EGR2
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1G5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant EGR2.
Formulation PBS with no preservative; pH 7.4
Gene EGR2
Gene Accession No. NM_000399
Gene Alias AT591/CMT1D/CMT4E/DKFZp686J1957/FLJ14547/KROX20
Gene Symbols EGR2
Host Species Mouse
Immunogen EGR2 (NP_000390.2, 217 a.a. ∼ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1959
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.