Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EIF2B5.

Manufacturer:  Abnova Corporation H00008893A01

Catalog No. 89-004-412


Add to cart

Description

Description

Sequence: LPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
Specifications

Specifications

eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa
Unconjugated
50% glycerol
NM_003907
CACH|CLE|EIF-2B|EIF2Bepsilon|LVWM
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8893
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant EIF2B5.
EIF2B5
Serum
EIF2B5
EIF2B5 (NP_003898, 622 a.a. ~ 720 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit