Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

EIF4EBP1, Mouse, Clone: 1F7, Abnova™

Catalog No. 89021410 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-410 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-410 Supplier Abnova Corporation Supplier No. H00001978M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant EIF4EBP1.

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq]

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

Antigen EIF4EBP1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1F7
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant EIF4EBP1.
Formulation PBS with no preservative; pH 7.4
Gene EIF4EBP1
Gene Accession No. BC004459
Gene Alias 4E-BP1/4EBP1/BP-1/MGC4316/PHAS-I
Gene Symbols EIF4EBP1
Host Species Mouse
Immunogen EIF4EBP1 (AAH04459, 1 a.a. ∼ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1978
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.