eukaryotic translation initiation factor 4E binding protein 1, Mouse, Clone: 4F3-H2, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant EIF4EBP1.

Supplier:  Abnova Corporation H00001978M01

Catalog No. 89-014-100

Description

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq]

Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

• Antigen: eukaryotic translation initiation factor 4E binding protein 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC004459
• Gene Symbols: EIF4EBP1
• Immunogen: EIF4EBP1 (AAH04459, 1 a.a. ∼ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Clone: 4F3-H2
• Description: Mouse monoclonal antibody raised against a full length recombinant EIF4EBP1.
• Gene: EIF4EBP1
• Gene Alias: 4E-BP1/4EBP1/BP-1/MGC4316/PHAS-I
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1978
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ