eukaryotic translation initiation factor 4E binding protein 2, Mouse, Clone: 2G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EIF4EBP2.

Supplier:  Abnova Corporation H00001979M04

Catalog No. 89-000-621

Description

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq

Sequence: DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Specifications

• Antigen: eukaryotic translation initiation factor 4E binding protein 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004096
• Gene Symbols: EIF4EBP2
• Immunogen: EIF4EBP2 (NP_004087, 61 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 1979
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2G8
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF4EBP2.
• Gene: EIF4EBP2
• Gene Alias: 4EBP2/PHASII
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody