eukaryotic translation initiation factor 4E binding protein 2, Mouse, Clone: 2G8, Abnova™

Catalog No.	Quantity
89-000-621	100 μg

Catalog No. 89-000-621 Supplier Abnova Corporation Supplier No. H00001979M04

Description

Mouse monoclonal antibody raised against a partial recombinant EIF4EBP2.

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq

Sequence: DRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Specifications

• Antigen: eukaryotic translation initiation factor 4E binding protein 2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2G8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF4EBP2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: EIF4EBP2
• Gene Accession No.: NM_004096
• Gene Alias: 4EBP2/PHASII
• Gene Symbols: EIF4EBP2
• Host Species: Mouse
• Immunogen: EIF4EBP2 (NP_004087, 61 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1979
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ