eukaryotic translation initiation factor 4E binding protein 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human EIF4EBP2 protein.

Manufacturer:  Abnova Corporation H00001979B01

Catalog No. 89-005-289

Description

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq

Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Specifications

• Antigen: eukaryotic translation initiation factor 4E binding protein 2
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC005057
• Gene Alias: 4EBP2|PHASII
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 1979

• Applications: Western Blot
• Description: Mouse polyclonal antibody raised against a full-length human EIF4EBP2 protein.
• Gene: EIF4EBP2
• Format: Serum
• Gene Symbols: EIF4EBP2
• Immunogen: EIF4EBP2 (AAH05057, 1 a.a. ~ 120 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human