eukaryotic translation initiation factor 4E binding protein 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human EIF4EBP2 protein.

Supplier:  Abnova Corporation H00001979B01

Catalog No. 89-005-289

Description

This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. [provided by RefSeq

Sequence: MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

Specifications

• Antigen: eukaryotic translation initiation factor 4E binding protein 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human EIF4EBP2 protein.
• Gene: EIF4EBP2
• Gene Alias: 4EBP2/PHASII
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 1979
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC005057
• Gene Symbols: EIF4EBP2
• Immunogen: EIF4EBP2 (AAH05057, 1 a.a. ∼ 120 a.a) full-length human protein.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum