Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

eukaryotic translation initiation factor 4E nuclear import factor 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89004682 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-682 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-682 Supplier Abnova Corporation Supplier No. H00056478A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant EIF4ENIF1.

The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ

Specifications

Antigen eukaryotic translation initiation factor 4E nuclear import factor 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant EIF4ENIF1.
Formulation 50% glycerol
Gene EIF4ENIF1
Gene Accession No. NM_019843
Gene Alias 4E-T/Clast4/FLJ21601/FLJ26551
Gene Symbols EIF4ENIF1
Host Species Mouse
Immunogen EIF4ENIF1 (NP_062817, 886 a.a. ∼ 985 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 56478
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.