Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

eukaryotic translation initiation factor 4E nuclear import factor 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant EIF4ENIF1.

Manufacturer:  Abnova Corporation H00056478A01

Catalog No. 89-004-682


Add to cart

Description

Description

The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
Specifications

Specifications

eukaryotic translation initiation factor 4E nuclear import factor 1
Unconjugated
50% glycerol
NM_019843
4E-T|Clast4|FLJ21601|FLJ26551
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
56478
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant EIF4ENIF1.
EIF4ENIF1
Serum
EIF4ENIF1
EIF4ENIF1 (NP_062817, 886 a.a. ~ 985 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit