eukaryotic translation initiation factor 4 gamma, 1, Mouse, Clone: 2A9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant EIF4G1.

Supplier:  Abnova Corporation H00001981M10

Catalog No. 89-014-101

Description

The protein encoded by this gene is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. Alternative splicing results in five transcript variants encoding four distinct isoforms. [provided by RefSeq]

Sequence: DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN

Specifications

• Antigen: eukaryotic translation initiation factor 4 gamma, 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_182917
• Gene Symbols: EIF4G1
• Immunogen: EIF4G1 (NP_886553, 1500 a.a. ∼ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2A9
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
• Gene: EIF4G1
• Gene Alias: DKFZp686A1451/EIF4F/EIF4G/p220
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1981
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ